Return-Path: <bounce-plcchdhbhdycybhmqhqqjmffbwhktqvqh@email.thegolfchannel.com>
Delivered-To: ajw@transocean.com
Received: from vps.transocean.com
	by vps.transocean.com with LMTP id mN9KOBYIrFriTAAAInt2oQ
	for <ajw@transocean.com>; Fri, 16 Mar 2018 11:08:22 -0700
Return-path: <bounce-plcchdhbhdycybhmqhqqjmffbwhktqvqh@email.thegolfchannel.com>
Envelope-to: ajw@transocean.com
Delivery-date: Fri, 16 Mar 2018 11:08:22 -0700
Received: from mail6.email.thegolfchannel.com ([96.46.140.230]:49833)
	by vps.transocean.com with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256)
	(Exim 4.89_1)
	(envelope-from <bounce-plcchdhbhdycybhmqhqqjmffbwhktqvqh@email.thegolfchannel.com>)
	id 1ewtlr-000577-WF
	for ajw@transocean.com; Fri, 16 Mar 2018 11:08:22 -0700
DKIM-Signature: v=1; a=rsa-sha1; c=relaxed/relaxed; s=default; d=email.thegolfchannel.com;
 h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type:list-unsubscribe; i=members@email.thegolfchannel.com;
 bh=W9TiGsngxL7Tuq4LwPHVbPC6FsE=;
 b=JC+LslmRZnOUqNek7PDvwEGz7pkYrqD1yLJSxENq5JjcjT87btCEN6wkJUFuet3gtiwQ/s9Dj98G
   P3PPwt97GA==
DomainKey-Signature: a=rsa-sha1; c=nofws; q=dns; s=default; d=email.thegolfchannel.com;
 b=QDwiR3nzYEszcrb6AGC/iJdf236oKid6cmz0KphlxxxiRmToYcSVQnZNx0w1OkWzixQrkHRF7PCo
   jHPXpkf9AA==;
Received: by mail6.email.thegolfchannel.com id hlg41u282akp for <ajw@transocean.com>; Fri, 16 Mar 2018 13:07:50 -0500 (envelope-from <bounce-plcchdhbhdycybhmqhqqjmffbwhktqvqh@email.thegolfchannel.com>)
Date: Fri, 16 Mar 2018 13:07:56 -0500 (CDT)
From: Golf Channel <members@email.thegolfchannel.com>
Reply-To: Golf Channel <r-chpjtqtftqgjgfvtzrdmdtcgmkggdtmsrmqtksrkdshlgn@email.thegolfchannel.com>
To: "ajw@transocean.com" <ajw@transocean.com>
Message-ID: <798379609.7024.1521223676272@email.thegolfchannel.com>
Subject: March Madness (In Every Swing)
MIME-Version: 1.0
Content-Type: multipart/alternative; 
	boundary="----=_Part_6973_505582918.1521223676136"
X-GLFC: sprvmrvlkrsjtbrbtcjsjrmvmb wbhfrprbmcpzccrbpgfplbzgfzrgjkcdtsblbtblcsctbmrbrrvmjj smpcbbkrb
list-unsubscribe: <mailto:unsub-7181-18474-B1CD2921549A44219ED981AEDA2E064F@email.thegolfchannel.com>  Precedence: Bulk
X-Spam-Status: No, score=-0.2
X-Spam-Score: -1
X-Spam-Bar: /
X-Ham-Report: Spam detection software, running on the system "vps.transocean.com",
 has NOT identified this incoming email as spam.  The original
 message has been attached to this so you can view it or label
 similar future email.  If you have any questions, see
 root\@localhost for details.
 
 Content preview:  Click to View Online: http://click1.email.thegolfchannel.com/ViewMessage.do?m=dcrtsrdr&r=kdpdlfl&s=bfjvpmklzlpgjzsjjlpznkzbpsnkslndqjt&q=1521223500&a=view
    ======================================================== [...] 
 
 Content analysis details:   (-0.2 points, 3.0 required)
 
  pts rule name              description
 ---- ---------------------- --------------------------------------------------
  0.0 URIBL_BLOCKED          ADMINISTRATOR NOTICE: The query to URIBL was blocked.
                             See
                             http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block
                              for more information.
                             [URIs: golfchannel.com]
  0.0 T_SPF_TEMPERROR        SPF: test of record failed (temperror)
 -0.0 T_RP_MATCHES_RCVD      Envelope sender domain matches handover relay
                             domain
  1.1 URI_HEX                URI: URI hostname has long hexadecimal sequence
  0.0 T_KAM_HTML_FONT_INVALID BODY: Test for Invalidly Named or Formatted
                             Colors in HTML
  0.6 HTML_IMAGE_RATIO_04    BODY: HTML has a low ratio of text to image area
 -1.9 BAYES_00               BODY: Bayes spam probability is 0 to 1%
                             [score: 0.0000]
  0.0 HTML_MESSAGE           BODY: HTML included in message
  0.1 DKIM_SIGNED            Message has a DKIM or DK signature, not necessarily valid
 -0.1 DKIM_VALID             Message has at least one valid DKIM or DK signature
X-Spam-Flag: NO

------=_Part_6973_505582918.1521223676136
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: quoted-printable

Click to View Online: http://click1.email.thegolfchannel.com/ViewMessage.do=
?m=3Ddcrtsrdr&r=3Dkdpdlfl&s=3Dbfjvpmklzlpgjzsjjlpznkzbpsnkslndqjt&q=3D15212=
23500&a=3Dview

=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=
=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=
=3D=3D=3D=3D=3D=3D


We all have golf shots we just don't like. What are yours?

Forced carries off the tee? Long bunker shots? Three-foot putts?

Start conquering the course by executing the shots you've always feared.=20=
This fall is the perfect time to focus in on some areas of the game you've=
 been trying to shore up.

http://click1.email.thegolfchannel.com/bpcvpmklzlpygjzsyjjlpyznkzybpsnkslnd=
qjtclgblg_pfmchdhbhmqhqqjmff.html

=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=
=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=
=3D=3D=3D=3D=3D=3D


This email was sent to you because you are a registered user and subscriber=
 of GolfChannel.com and/or GolfNow.com.=20

To update your preferences or change your email address, click here  http:/=
/click1.email.thegolfchannel.com/dtmztwkpjptfcrjlfrrptfjbkjfstlbklpbgmrndpc=
spm_pfmchdhbhmqhqqjmff.html

To unsubscribe from GolfChannel.com emails, click here www.golfchannel.com/=
user/unsubscribe/?email=3Dajw@transocean.com&newsletter=3D6
           =20
Please DO NOT REPLY TO THIS MESSAGE. For all inquiries, please If you are=
 having problems contacting us, send a letter c/o Webmaster to 7580 Golf=20=
Channel Drive, Orlando, FL 32819.
------=_Part_6973_505582918.1521223676136
Content-Type: text/html; charset=UTF-8
Content-Transfer-Encoding: quoted-printable



<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.=
w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd">
<html xmlns=3D"http://www.w3.org/1999/xhtml">
<head>
<meta http-equiv=3D"Content-Type" content=3D"text/html; charset=3Dutf-8"=20=
/>


<meta name=3D"viewport" content=3D"width=3Ddevice-width, initial-scale=3D1,=
 maximum-scale=3D1, user-scalable=3D0" />

<meta http-equiv=3D"X-UA-Compatible" content=3D"IE=3Dedge" />
<title>Golf Channel</title>
<link rel=3D"icon" href=3D"https://www.golfnow.com/favicon.ico" type=3D"ima=
ge/x-icon" />

<link href=3D'http://fonts.googleapis.com/css?family=3DRoboto' rel=3D'style=
sheet' type=3D'text/css'>

<style type=3D"text/css">
=09
=09body,
=09#bodyTable {
=09=09height:100% !important;
=09=09width:100% !important;
=09=09margin:0;
=09=09padding:0;
=09}
=09=09
=09
=09body,
=09table,
=09td,
=09p,
=09a,
=09li,
=09blockquote {
=09=09-ms-text-size-adjust:100%;
=09=09-webkit-text-size-adjust:100%;
=09}

=09
=09.msg-body {
=09=09width: 100% !important;
=09=09display: block !important
=09}

=09
    =09.ReadMsgBody
    =09.ExternalClass {
=09=09width: 100%;
=09=09background-color: #f0f0f0;
    =09}

=09
=09.ExternalClass,
=09.ExternalClass p,
=09.ExternalClass span,
=09.ExternalClass font,
=09.ExternalClass td,
=09.ExternalClass div {
=09=09line-height:100%;
    =09}

    =09
    =09table {
=09border-spacing:0;
    =09}

    =09
    =09table,
    =09td {
=09=09border-collapse:collapse;
=09=09mso-table-lspace:0pt;
=09=09mso-table-rspace:0pt;
    =09}
   =20
    =09
    =09img {
    =09=09-ms-interpolation-mode: bicubic;
    =09}
   =20
    =09
    =09img,
    =09a img {
    =09=09border:0;
    =09=09outline:none;
    =09=09text-decoration:none;=09   =20
    =09}

    =09
    =09.yshortcuts a {
=09=09border-bottom: none !important;
    =09}
   =20

=09@media screen and (max-device-width: 655px), screen and (max-width: 655p=
x) {
=09
=09
=09=09=09td=
[class]=
=2EPaddingLeft15 { padding-left:15px !important; }
=09
=09}

 =20
 =20
    @media screen and (max-device-width: 602px), screen and (max-width: 602=
px) {

=09
=09table=
[class]=
=2Eemail-container {
=09=09width: 100% !important;
=09=09border-right:none !important;
=09=09border-left:none !important;
=09}
=09
=09
=09table=
[class]=
=2Efluid {
=09=09width: 100% !important;
=09}
=09=09=09
=09
=09img=
[class]=
=2Efluid,
=09img=
[class]=
=2Eforce-col-center {
=09=09width: 100% !important;
=09=09max-width: 100% !important;
=09=09height: auto !important;
=09}
=09
=09
=09img=
[class]=
=2Eforce-col-center {
=09=09margin: auto !important;
=09}
=09=09=09
=09
=09td=
[class]=
=2Eforce-col,
=09td=
[class]=
=2Eforce-col-center {
=09=09display: block !important;
=09=09width: 100% !important;
=09=09clear: both;
=09}
=09
=09
=09td=
[class]=
=2Eforce-col-center {
=09=09text-align: center !important;
=09}
=09=09=09
=09
=09img=
[class]=
=2Ecol-3-img-l {
=09=09float: left;
=09=09margin: 0 15px 15px 0;
=09}
=09
=09
=09img=
[class]=
=2Ecol-3-img-r {
=09=09float: right;
=09=09margin: 0 0 15px 15px;
=09}
=09=09=09
=09
=09img=
[class]=
=2Ecol-2-img-l {
=09=09float: left;
=09=09margin: 0 15px 15px 0;
=09}
=09
=09
=09img=
[class]=
=2Ecol-2-img-r {
=09=09float: right;
=09=09margin: 0 0 15px 15px;
=09}
=09
=09=09
=09=09
=09td=
[class]=
=2ENoPadding { padding:0 !important; }
        =20
    }
=09
=09
=09@media screen and (max-device-width: 500px), screen and (max-width: 500p=
x) {
=09
=09=09
=09=09td=
[class]=
=2EPaddingLeft15 { padding-left:15px !important; }
=09=09img=
[id]=
#Logo {
=09=09=09=09margin: auto !important;
=09=09=09}
=09=09
=09=09
=09}
=09
=09@media screen and (max-device-width: 475px), screen and (max-width: 475p=
x) {
=09
=09
=09td=
[class]=
=2Ehh-header-center {
=09=09display: block !important;
=09=09width: 100% !important;
=09=09clear: both;
=09}
=09
=09
=09td=
[class]=
=2Ehh-header-center {
=09=09text-align: center !important;
=09}
=09
=09
=09=09td=
[class]=
=2EPaddingLeft15 { padding-left:0 !important; }
=09=09img=
[id]=
#Logo {
=09=09=09=09margin: auto !important;
=09=09=09}
=09td=
[id]=
#NavRewards { padding-left:30px !important; padding-right:30px !important;=
 }
=09
=09}
=09

   =20
    @media screen and (max-device-width: 425px), screen and (max-width: 425=
px) {

=09
=09div=
[class]=
=2Ehh-visible {
=09=09display: block !important;
=09}
=09
=09div=
[class]=
=2Ehh-center {
=09=09text-align: center;
=09=09width: 100% !important;
=09}
=09=09=09
=09
=09table=
[class]=
=2Ehh-fluid {
=09=09width: 100% !important;
=09}
=09=09=09
=09
=09img=
[class]=
=2Ehh-fluid,
=09img=
[class]=
=2Ehh-force-col-center {
=09=09width: 100% !important;
=09=09max-width: 100% !important;
=09=09height: auto !important;
=09}
=09
=09
=09img=
[class]=
=2Ehh-force-col-center {
=09=09margin: auto !important;
=09}
=09=09=09
=09
=09td=
[class]=
=2Ehh-force-col,
=09td=
[class]=
=2Ehh-force-col-center {
=09=09display: block !important;
=09=09width: 100% !important;
=09=09clear: both;
=09}
=09td=
[class]=
=2Eforce-col { padding-bottom:15px !important; }
=09
=09
=09td=
[class]=
=2Ehh-force-col-center {
=09=09text-align: center !important;
=09}
=09
=09td=
[class]=
#Column1of2 { padding-right:0 !important; }
=09=09=09
=09
=09td=
[class]=
=2Ehh-spacer { padding-top:30px !important; }
=09=09=09
=09
=09img=
[class]=
=2Ecol-3-img-l,
=09img=
[class]=
=2Ecol-3-img-r {
=09=09float: none !important;
=09=09margin: 15px auto !important;
=09=09text-align: center !important;
=09}
=09=09=09
=09
=09img=
[class]=
=2Ecol-2-img-l,
=09img=
[class]=
=2Ecol-2-img-r {
=09=09float: none !important;
=09=09margin: 15px auto 0 !important;
=09=09text-align: center !important;
=09=09width:100% !important;
=09=09height:auto !important;
=09}


=09*=
[class]=
=2Ehide {display:none !important; }
=09
=09div=
[id]=
#BookByPhone {
=09=09background-color:#0076bb !important;
=09=09background-image: url('http://image.email.golfnow.com/lib/fe931372756=
c0c7d76/m/5/book_by_phone.gif') !important;
=09=09background-repeat:no-repeat !important;
=09=09background-position:center top !important;
=09=09height:29px !important;
=09=09border:none !important;
=09}

=09
=09td=
[id]=
#gnPhoneWrapper {
=09=09background-color:#0076bb !important;
=09=09color:#eef6fa !important;=09
=09}
=09a=
[id]=
#gnPhoneNumber {
=09=09color:#ffffff !important;
=09=09text-shadow: 0px 3px 5px rgba(150, 150, 150, 1) !important;=09
=09}
=09a=
[id]=
#gnTimeZone {
=09=09color:#eef6fa !important;=09
=09}
=09
=09/* Fixes 20px padding to the right on mobile */
=09td=
[class]=
=2ENoPadding { padding:0 !important; }
=09
=09/* Heading Styles */
=09*=
[class]=
=2EH1 { font-size:22px !important; }
=09*=
[class]=
=2EH2 { font-size:16px !important; }
=09*=
[class]=
=2EH3 { font-size:14px !important; }
=09
    }

  </style>
</head>
<body leftmargin=3D"0" topmargin=3D"0" marginwidth=3D"0" marginheight=3D"0"=
 bgcolor=3D"#f0f0f0" style=3D"margin:0; padding:0; -webkit-text-size-adjust=
:none; -ms-text-size-adjust:none;">

<div style=3D"display:none;font-size:1px;color:#{color};line-height:1px;fon=
t-family:{font};max-height:0px;max-width:0px;opacity:0;overflow:hidden;mso-=
hide:all;">
=09<!--=
[if !mso 9]=
><!-->
<span style=3D"display:none !important;visibility:hidden;opacity:0;color:tr=
ansparent;height:0;width:0;">
Does this word hit too close to home?=20
</span><!--<!=
[endif]=
-->

</div>

<table cellpadding=3D"0" cellspacing=3D"0" border=3D"0" height=3D"100%" wid=
th=3D"100%" bgcolor=3D"#f0f0f0" id=3D"bodyTable"><tr><td valign=3D"top" ali=
gn=3D"center">


    <table border=3D"0" width=3D"600" cellpadding=3D"0" cellspacing=3D"0"=
 align=3D"center" bgcolor=3D"#ffffff" class=3D"email-container" style=3D"bo=
rder:1px solid #bebebe;">

      <tr>
        <td bgcolor=3D"#c6ddea"><a href=3D"http://click1.email.thegolfchann=
el.com/vkjdfzbvyvfnhkyqnkkvfnycbynmfqcbqvcrgktjvhmfg_pfmchdhbhmqhqqjmff.htm=
l?a=3Dhttp%3A%2F%2Fgolfchannelacademy.com%2Fkelley-brooke%2F" target=3D"_bl=
ank" alias=3D"AcademyURL"><img src=3D"http://image.email.golfnow.com/lib/fe=
931372756c0c7d76/m/6/gca_header_062016.png" alt=3D"Golf Academy" title=3D"G=
olf Academy" height=3D"120" width=3D"600" border=3D"0" style=3D"display:=20=
block; font-family: 'Roboto', Arial, sans-serif; font-size: 22px; line-heig=
ht:120%; color: #000000; text-align:center;" class=3D"fluid" /></a></td>
      </tr>

      <tr>
        <td align=3D"center" bgcolor=3D"#c6ddea">
          <table border=3D"0" width=3D"100%" cellpadding=3D"0" cellspacing=
=3D"0" align=3D"center">
            <tr>
              <td class=3D"outlookFont H1" style=3D"padding: 0 30px 4px;=20=
font-family: 'Roboto', Arial, sans-serif; font-size: 32px; line-height:130%=
; color: #0076bb; font-weight:normal;" align=3D"center"><strong> Madness</s=
trong></td>
            </tr>
            <tr>
              <td class=3D"outlookFont H2" style=3D"padding: 0 30px 10px;=
 font-family: 'Roboto', Arial, sans-serif; font-size: 18px; line-height:125=
%; color: #0076bb; font-weight:normal;" align=3D"center"><em>Noun - a state=
 of frenzied or chaotic activity.</em></td>
            </tr>
          </table>
        </td>
      </tr>

      <tr>
        <td align=3D"center" bgcolor=3D"#c6ddea">
          <table border=3D"0" width=3D"100%" cellpadding=3D"0" cellspacing=
=3D"0" align=3D"center">
            <tr>
              <td class=3D"outlookFont" style=3D"padding: 15px 30px 30px;=
 font-family: 'Roboto', Arial, sans-serif; font-size: 17px; line-height:135=
%; color: #666666;" align=3D"left">Does this word hit a little too close=20=
when it comes to your golf game? You aren=E2=80=99t alone. We can help you.=
=20
<br /><br />
At <a href=3D"http://click1.email.thegolfchannel.com/yfgystrlvlsnkfvpnfflsn=
vwrvncspwrplwmgfzblkcsb_pfmchdhbhmqhqqjmff.html?a=3Dhttp%3A%2F%2Fgolfchanne=
lacademy.com%2Fkelley-brooke%2F" target=3D"_blank" style=3D"color:#666666;=
 text-decoration:none; font-weight:bold;" alias=3D"AcademyName">Golf Channe=
l Academy with Kelley Brooke</a>, we're home to some of the best coaches=20=
in the area, but we also take a different approach to teaching golf. We val=
ue relationships with our students and seek to provide the best environment=
 for learning that we can. Our students' goals are ours and yours could be=
 too.<br /><br />
Get started with a 1-hour New Student Assessment for only $90! After a full=
-game evaluation using our ES 15 launch monitors, we will be able to custom=
ize a coaching and training plan so that you can learn more effectively.</t=
d>
            </tr>
          </table>
        </td>
      </tr>

      <tr>
        <td style=3D"padding:0 30px;" align=3D"center" bgcolor=3D"#c6ddea">=
<table class=3D"fluid" width=3D"250" cellpadding=3D"0" cellspacing=3D"0"=20=
border=3D"0" align=3D"center">
                                                      <tr>
                                                          <td style=3D"widt=
h: 250px; height:45px; background:#0076bb; font-size: 22px; line-height:=20=
22px; text-align: center;  -moz-border-radius:2px; -webkit-border-radius:2p=
x; border-radius:2px; border-bottom:5px solid #004d7d;">
                                                          <a href=3D"http:/=
/click1.email.thegolfchannel.com/xprkdqlvcvdtrpcntppvdtcylctsdnylnvygbpmjvr=
sds_pfmchdhbhmqhqqjmff.html?a=3Dhttp%3A%2F%2Fgolfchannelacademy.com%2Fkelle=
y-brooke%2F" class=3D"outlookFont button" target=3D"_blank" style=3D"font-f=
amily: 'Roboto', Arial, sans-serif; font-size: 22px; line-height: 22px; col=
or: #ffffff; text-decoration: none; display: block; padding: 12px 0;" alias=
=3D"AcademyURL"><strong>Learn More</strong></a>
                                                          </td>
                                                      </tr>
                                                  </table>
        </td>
      </tr>
    =20
      <tr>
        <td bgcolor=3D"#c6ddea"><a href=3D"http://click1.email.thegolfchann=
el.com/zbbvrqjmfmrksbfgkbbmrkfcjfkdrgcjgmczlbtwmsdrf_pfmchdhbhmqhqqjmff.htm=
l?a=3Dhttp%3A%2F%2Fgolfchannelacademy.com%2Fkelley-brooke%2F" target=3D"_bl=
ank" alias=3D"AcademyURL"><img src=3D"https://c1.staticflickr.com/5/4773/39=
796845295_757a4cd598_o.jpg" alt=3D"Improve your swing today!" height=3D"380=
" width=3D"600" border=3D"0" style=3D"display: block;" class=3D"fluid" /></=
a></td>
      </tr>

  </table>
  <table align=3D"center" bgcolor=3D"#f4f4f4" border=3D"0" cellpadding=3D"0=
" cellspacing=3D"0" class=3D"email-container" width=3D"600">
=09=09=09=09=09<tbody>
=09=09=09=09=09=09<tr>
=09=09=09=09=09=09=09<td align=3D"center" bgcolor=3D"#f4f4f4" class=3D"emai=
l-container" height=3D"44" style=3D"padding:35px 0 15px 0;" valign=3D"middl=
e" width=3D"600">
=09=09=09=09=09=09=09=09<table align=3D"center" border=3D"0" cellpadding=3D=
"0" cellspacing=3D"0">
=09=09=09=09=09=09=09=09=09<tbody>
=09=09=09=09=09=09=09=09=09=09<tr>
=09=09=09=09=09=09=09=09=09=09=09<td style=3D"padding:0 7px;">
=09=09=09=09=09=09=09=09=09=09=09=09<a href=3D"http://click1.email.thegolfc=
hannel.com/dppztwkpjptfcrjlfrrptfjbkjfstlbklpbgmrndpcspg_pfmchdhbhmqhqqjmff=
=2Ehtml" target=3D"_blank"><img alt=3D"Facebook" border=3D"0" height=3D"44"=
 src=3D"http://images.thegolfchannel.com/images/email/480933.gif" style=3D"=
display:block;color:#444444; font-family:helvetica,arial,sans-serif; font-s=
ize:13px; line-height:130%; text-align:center;" width=3D"44" /></a></td>
=09=09=09=09=09=09=09=09=09=09=09<td style=3D"padding:0 7px;">
=09=09=09=09=09=09=09=09=09=09=09=09<a href=3D"http://click1.email.thegolfc=
hannel.com/lkmsmcpkhkmrjdhfrddkmrhlphrqmflpfklzndywkjqkm_pfmchdhbhmqhqqjmff=
=2Ehtml" target=3D"_blank"><img alt=3D"Twitter" border=3D"0" height=3D"44"=
 src=3D"http://images.thegolfchannel.com/images/email/480934.gif" style=3D"=
display:block;color:#444444; font-family:helvetica,arial,sans-serif; font-s=
ize:13px; line-height:130%; text-align:center;" width=3D"44" /></a></td>
=09=09=09=09=09=09=09=09=09=09=09<td style=3D"padding:0 7px;">
=09=09=09=09=09=09=09=09=09=09=09=09<a href=3D"http://click1.email.thegolfc=
hannel.com/khtwlqkhphljvrpbjrrhljpzkpjflbzkbhztsrgdhvfhh_pfmchdhbhmqhqqjmff=
=2Ehtml" target=3D"_blank"><img alt=3D"Instagram" border=3D"0" height=3D"44=
" src=3D"http://images.thegolfchannel.com/images/email/480936.gif" style=3D=
"display:block;color:#444444; font-family:helvetica,arial,sans-serif; font-=
size:13px; line-height:130%; text-align:center;" width=3D"44" /></a></td>
=09=09=09=09=09=09=09=09=09=09</tr>
=09=09=09=09=09=09=09=09=09</tbody>
=09=09=09=09=09=09=09=09</table>
=09=09=09=09=09=09=09</td>
=09=09=09=09=09=09</tr>
=09=09=09=09=09</tbody>
=09=09=09=09</table>
  <table align=3D"center" bgcolor=3D"#f4f4f4" border=3D"0" cellpadding=3D"0=
" cellspacing=3D"0" class=3D"email-container" width=3D"600">
=09=09=09=09=09<tbody>
=09=09=09=09=09=09<tr>
=09=09=09=09=09=09=09<td align=3D"center" bgcolor=3D"#f4f4f4" class=3D"emai=
l-container" id=3D"footerText" style=3D"padding:15px; font-size:12px; line-=
height:19px; font-family:Arial, Helvetica, sans-serif; font-weight:normal;=
 color:#888888;" valign=3D"top" width=3D"100%">
=09=09=09=09=09=09=09=09<a class=3D"footer" href=3D"http://click1.email.the=
golfchannel.com/iycpyqkhchywmbctwbbhywcrkcwzytrkthrgdbfnhmzhv_pfmchdhbhmqhq=
qjmff.html" style=3D"text-decoration:none; font-size:13px; font-family:Aria=
l, Helvetica, sans-serif; font-weight:bold; color:#888888;">Privacy Policy<=
/a><span class=3D"hide" style=3D"font-size:12px; font-family:Arial, Helveti=
ca, sans-serif; font-weight:bold; color:#bababa;">&nbsp;|&nbsp;</span><a=20=
class=3D"footer" href=3D"http://click1.email.thegolfchannel.com/rcwycbfrlrc=
pgklhpkkrcplsflpwchsfhrsjvkqtrgwrk_pfmchdhbhmqhqqjmff.html?a=3Demail_GCA_20=
180316" style=3D"text-decoration:none; font-size:13px; font-family:Arial,=
 Helvetica, sans-serif; font-weight:bold; color:#888888;" target=3D"_blank"=
>Contact Us</a><span class=3D"hide" style=3D"font-size:12px; font-family:Ar=
ial, Helvetica, sans-serif; font-weight:bold; color:#bababa;">&nbsp;|&nbsp;=
</span><a class=3D"footer" href=3D"http://www.email.thegolfchannel.com/Unsu=
b.do?a=3Du&e=3Dajw%40transocean.com&mid=3D18474&sid=3DB1CD2921-549A-4421-9E=
D9-81AEDA2E064F&rid=3D7181&lid=3D6" id=3D"unsubFooter" style=3D"text-decora=
tion:none; font-size:13px; font-family:Arial, Helvetica, sans-serif; font-w=
eight:bold; color:#888888;" target=3D"_blank">Unsubscribe</a><br /><a href=
=3D"#" id=3D"address" style=3D"color: #888888; text-decoration: none;">7580=
 Golf Channel Dr, Orlando, FL 32819</a><span class=3D"hide" style=3D"font-s=
ize:12px; font-family:Arial, Helvetica, sans-serif;font-weight:bold; color:=
#bababa;">&nbsp;|&nbsp;</span><a class=3D"hide" href=3D"http://click1.email=
=2Ethegolfchannel.com/ViewMessage.do?m=3Dfjbdrbgb&r=3Dkdpdlfl&s=3Dzpbvrqjmf=
mrsbfgbbmrfcjfdrgcjgmczlbt&q=3D1521223500&a=3Dview" style=3D"color: #888888=
; text-decoration: none;" target=3D"_blank">View this online</a></td>
=09=09=09=09=09=09</tr>
=09=09=09=09=09</tbody>
=09=09=09=09</table>


<img src=3D"https://e48e0c.efeedbacktrk.com/mtsmcvgqpqclntpzlttqclpjgplsczj=
gzqjwdtkbqnscn_pfmchdhbhmqhqqjmff.gif" width=3D"0" height=3D"0" alt=3D"">

</td></tr></table>
</body>
</html>



------=_Part_6973_505582918.1521223676136--