Return-Path: Delivered-To: ajw@transocean.com Received: from vps.transocean.com by vps.transocean.com with LMTP id QD3JMbqWoVq/NgAAInt2oQ for ; Thu, 08 Mar 2018 12:02:02 -0800 Return-path: Envelope-to: ajw@transocean.com Delivery-date: Thu, 08 Mar 2018 12:02:02 -0800 Received: from mail6.email.thegolfchannel.com ([96.46.140.230]:40820) by vps.transocean.com with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.89_1) (envelope-from ) id 1eu1jZ-0003ih-7f for ajw@transocean.com; Thu, 08 Mar 2018 12:02:02 -0800 DKIM-Signature: v=1; a=rsa-sha1; c=relaxed/relaxed; s=default; d=email.thegolfchannel.com; h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type:list-unsubscribe; i=members@email.thegolfchannel.com; bh=/Lv7eX2kE6MuBxsJZhLcKn4Z6D0=; b=uMav3J4F9qU+hifdxLE2wektB4I0QjSaNuaC20d626i5bt/MbQDoOI7AQmIadl940Jx1/YOMOnwq XzbTCKH9nQ== DomainKey-Signature: a=rsa-sha1; c=nofws; q=dns; s=default; d=email.thegolfchannel.com; b=iCPl9Qag5HdLYyKKohPKJlJNKdG1vGbW/PfFL8bji3G368j0rMIlfw4D8KXDi6tq1gas8HUS7HVG 8Z45+gXBJQ==; Received: by mail6.email.thegolfchannel.com id hk6bbu282akb for ; Thu, 8 Mar 2018 14:01:25 -0600 (envelope-from ) Date: Thu, 8 Mar 2018 14:01:30 -0600 (CST) From: Golf Channel Reply-To: Golf Channel To: "ajw@transocean.com" Message-ID: <183288412.8237040.1520539290590@email.thegolfchannel.com> Subject: =?UTF-8?B?VE9VUjM2MCDigJMgRGlzY292ZXIgYWxsIG5ldw==?= =?UTF-8?B?IGNvbG9yd2F5cyBmcm9tIGFkaWRhcyBHb2xm?= MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_8237039_1290629613.1520539290590" X-GLFC: zwsbbspsrwpmkrmrklwlwdslfm vrqjmfmrsbfgbbmrfcjfdrgcjgmczlbtkwrdrkrdblzkrsmzspfmzz rrmmrpwbmb list-unsubscribe: Precedence: Bulk X-Spam-Status: No, score=-2.8 X-Spam-Score: -27 X-Spam-Bar: -- X-Ham-Report: Spam detection software, running on the system "vps.transocean.com", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: Click to View Online: http://click1.email.thegolfchannel.com/ViewMessage.do?m=vfyfmkgr&r=cjmjtqt&s=uwgvhkbqcqhngczggqhcjbcmhzjbzqjyfgd&q=1520539200&a=view ======================================================== [...] Content analysis details: (-2.8 points, 3.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: thegolfchannel.com] -2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact safe-sa@returnpath.net [Return Path SenderScore Safe List (formerly] [Habeas Safelist) - ] -0.0 T_RP_MATCHES_RCVD Envelope sender domain matches handover relay domain 0.0 T_SPF_TEMPERROR SPF: test of record failed (temperror) 1.1 URI_HEX URI: URI hostname has long hexadecimal sequence 0.0 HTML_IMAGE_RATIO_06 BODY: HTML has a low ratio of text to image area -1.9 BAYES_00 BODY: Bayes spam probability is 0 to 1% [score: 0.0000] 0.0 HTML_FONT_LOW_CONTRAST BODY: HTML font color similar or identical to background 0.0 HTML_MESSAGE BODY: HTML included in message -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid X-Spam-Flag: NO ------=_Part_8237039_1290629613.1520539290590 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable Click to View Online:=20= http://click1.email.thegolfchannel.com= /ViewMessage.do?m=3Dvfyfmkgr&r=3D= cjmjtqt= &s=3Duwgvhkbqcqhngczggqhcjbcmhzjbzqjyfgd&q=3D= 1520539200= &a=3Dview =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D TOUR360 =E2=80=93 Discover all new colorways from adidas Golf http://click1.email.thegolfchannel.com/smpwbhfrprbtmcpztccrbtpgfptlbzgfzrgj= kcdsrvmkc_= scssblbtbmrjmvprjj= =2Ehtml =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D This email was sent to you because you are a registered user and subscriber= of GolfChannel.com and/or GolfNow.com.=20 To update your preferences or change your email address, click here http:/= /click1.email.thegolfchannel.com/jvfcbkhrnrbwvtnzwttrbwnphnwfbzphzrpsmtdqrj= vmv_= scssblbtbmrjmvprjj= =2Ehtml To unsubscribe from GolfChannel.com emails, click here www.golfchannel.com/= user/unsubscribe/?email=3D= ajw@transocean.com= &newsletter=3D= 5 =20 Please DO NOT REPLY TO THIS MESSAGE. For all inquiries, please If you are= having problems contacting us, send a letter c/o Webmaster to 7580 Golf=20= Channel Drive, Orlando, FL 32819. ------=_Part_8237039_1290629613.1520539290590 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable Tour360 =E2=80=93 Discover endless performance from adidas Golf<= /title> <style type=3D"text/css"> /* reset */ #outlook a { padding: 0; } /* Force Outlook to provide a "view in browser" menu link. */ .ExternalClass { width: 100%; } /* Force Hotmail to display emails at full width */ .ExternalClass, .ExternalClass p, .ExternalClass span, .ExternalClass font, .ExternalClass td, .ExternalClass div { line-height: 100%; } /* Forces Hotmail to display normal line spacing. More on that:=20= http://www.emailonacid.com/forum/viewthread/43/ */ p { margin: 0; padding: 0; font-size: 0px; line-height: 0px; } /* squash Exact Target injected paragraphs */ table td { border-collapse: collapse; } /* Outlook 07, 10 padding issue fix */ table { border-collapse: collapse; mso-table-lspace: 0pt; mso-table-rspace: 0pt; } /* remove spacing around Outlook 07, 10 tables */ /* bring inline */ img { display: block; outline: none; text-decoration: none; -ms-interpolation-mode: bicubic; } a img { border: none; } a { text-decoration: none; color: #000001; } /* text link */ a.phone { text-decoration: none; color: #000001 !important; pointer-events: auto; cursor: default; } /* phone link, use as wrapper on phone numbers */ span { font-size: 13px; line-height: 17px; font-family: monospace; color: #000001; } .aBn { border-bottom: 0 !important; cursor: default !important; } =2Ex-gmail-data-detectors { border-bottom: 0 !important; cursor: default !important; } </style> <!--= [if gte mso 9]= > <style> /* Target Outlook 2007 and 2010 */ </style> <!= [= endif]= --> </head> <body style=3D"width:100%; margin:0; padding:0; -webkit-text-size-adjust:10= 0%; -ms-text-size-adjust:100%;"> <!-- Preview Text --> <div style=3D"display:none;font-size:1px;color:#ffffff;line-height:1px;= max-height:0px;max-width:0px;opacity:0;overflow:hidden;">Unparalleled stabi= lity. Premium performance. Energized comfort. The new TOUR360.</div> <!-- body wrapper --> <table cellpadding=3D"0" cellspacing=3D"0" border=3D"0" style=3D"margin:0;= padding:0; width:100%; line-height: 100% !important;"> <tr> <td valign=3D"top"> <!-- edge wrapper --> <table cellpadding=3D"0" cellspacing=3D"0" border=3D"0" ali= gn=3D"center" width=3D"600" style=3D"background: #ffffff;"> <tr> <td valign=3D"top"> <!-- content wrapper --> <table cellpadding=3D"0" cellspacing=3D"0" bord= er=3D"0" align=3D"center" width=3D"560" style=3D"background: #ffffff;"> <tr> <td valign=3D"top" style=3D"vertical-al= ign: top;"> <!-- //////////////////////////////= /////////////////////// --> <table cellpadding=3D"0" cellspacin= g=3D"0" border=3D"0" align=3D"center"> =20 =20 <tr> <td valign=3D"top" style=3D= "vertical-align: top;"> <a href=3D"http://click= 1.email.thegolfchannel.com/yckystrlvlsnkfvpnfflsnvwrvncspwrplwmgfzblqkkv_= scssblbtbmrjmvprjj= =2Ehtml?a=3D= email_Adidas_20180308= "> <img src=3D"https://farm3.staticflickr.com/2935/14145416504_5dd6eac= c7a_o.jpg" alt=3D"Golf Channel" title=3D"The New adidas Tour360 - Learn Mor= e" /> </a> </td> </tr> <tr> <td valign=3D"top" style=3D= "vertical-align: top;">  =20 </td> </tr> <tr> <td valign=3D"top" style=3D= "vertical-align: top;"> <a href=3D"http://click= 1.email.thegolfchannel.com/oljstngzqztdwkqcdkkztdqpgqdmtcpgczpflkvrzjwlf_= scssblbtbmrjmvprjj= =2Ehtml"> <img src=3D"https://c1.staticflickr.com/5/4786/39969076914_64e13b5b= c5_o.gif" alt=3D"The New adidas Tour360 - Learn More" title=3D"The New adid= as Tour360 - Learn More" /> </a> </td> </tr> </table> <table cellpadding=3D"0" cellspacin= g=3D"0" border=3D"0" align=3D"center"> <tr> <td valign=3D"top" style=3D= "vertical-align: top; padding: 10px 5px 10px 0px;"><a href=3D"http://click1= =2Eemail.thegolfchannel.com/mdqmcvgqpqclntpzlttqclpjgplsczjgzqjwdtkbqyndc_= scssblbtbmrjmvprjj= =2Ehtml"><img src=3D"https://i.imgur.com/Au4zl2z.jpg" alt=3D"Unparalleled= Stability - Enhanced TPU Plate Wraps Higher For Increased Performance" tit= le=3D"Unparalleled Stability - Enhanced TPU Plate Wraps Higher For Increase= d Performance" /></a> </td> <td valign=3D"top" style=3D= "vertical-align: top; padding: 10px 0px 10px 5px;"><a href=3D"http://click1= =2Eemail.thegolfchannel.com/hwvjvprqfqvzcsflzssqvzfdrfzmvldrlqdnwsghqbcwq_= scssblbtbmrjmvprjj= =2Ehtml"><img src=3D"https://i.imgur.com/6i3Yngb.jpg" alt=3D"Premium Perfor= mance - More Traditional Collar Shape Combined with Soft, Durable Leather= for Lasting Comfort + Fit" title=3D"Premium Performance - More Traditional= Collar Shape Combined with Soft, Durable Leather for Lasting Comfort + Fit= " /></a> </td> </tr> </table> <table cellpadding=3D"0" cellspacin= g=3D"0" border=3D"0" align=3D"center"> <tr> <td valign=3D"top" style=3D= "vertical-align: top;"><a href=3D"http://click1.email.thegolfchannel.com/fn= qtdlzsysdwjbycwbbsdwypzywrdcpzcspqnbfgshjnh_= scssblbtbmrjmvprjj= =2Ehtml"><img src=3D"https://i.imgur.com/o5putWq.jpg" alt=3D"Energized Comf= ort - Full Length Boost Midsole Foam For Unrivaled Cushioning + Endless Ene= rgy" title=3D"Energized Comfort - Full Length Boost Midsole Foam For Unriva= led Cushioning + Endless Energy" /></a> </td> </tr> <tr> <td valign=3D"top" style=3D= "vertical-align: top;">  =20 </td> </tr> =20= =20 </table> <!-- //////////// --> </td> </tr> </table> <!-- / content wrapper --> </td> </tr> </table> <!-- / edge wrapper --> </td> </tr> </table> <table align=3D"center"> <tr> <td align=3D"center"> <p><font style=3D"font-f= amily:Arial, Helvetica, sans-serif; font-size:12px; line-height:110%; color= :#000000;"><em>To unsubscribe from this Golf Channel email, please</em> <a= href=3D"= http://www.email.thegolfchannel.com/Unsub.do?= a=3Du&e=3D= ajw%40transocean.com= &mid=3D18460&sid=3DB1CD2921-549A-4421-9ED9-81AEDA2E064F&rid=3D= 7181= &lid=3D5" style=3D"color: #006699;"><em>click here</em></a>. <br/><br/> <em>Golf Channel<br/>= 7580 Golf Channel Drive, Orlando, FL 32819.</em></font></p> <p><img src=3D"https://e5= 350c.efeedbacktrk.com/dsmztwkpjptfcrjlfrrptfjbkjfstlbklpbgmrndphccs_= scssblbtbmrjmvprjj= =2Egif" width=3D"0" height=3D"0" alt=3D""> </p> <p><span class=3D"x-gmail= -data-detectors" style=3D"padding: 40px 10px;width: 100%;font-size: 12px;= font-family: sans-serif; line-height:18px; text-align: center; color: #000= 000;"> <br /><br /> <webversion= style=3D"color:#cccccc; text-decoration:underline; font-weight: bold;"><a= style=3D"color:#000000; text-decoration:underline;" href=3D"= http://click1.email.thegolfchannel.com= /ViewMessage.do?m=3Ddtjtsrmg&r=3D= cjmjtqt= &s=3Dthbslrfzpzlvbpdbbzlptfpjldtfdztwcbg&q=3D= 1520539200= &a=3Dview">View as a Web Page</a></webversion> </span><img src=3D"https:= //ad.doubleclick.net/ddm/trackimp/N6311.128147NBCUNIVERSAL/B20709225.213893= 043;dc_trk_aid=3D413115063;dc_trk_cid=3D97680315;ord=3D%5btimestamp%5d;dc_l= at=3D;dc_rdid=3D;tag_for_child_directed_treatment" width=3D"1" height=3D"1"= class=3D"wrapper" style=3D"display:block;border:none;" border=3D"0" ></p> =20 =20 =20 </td> </tr> </table> <!-- / page wrapper --> </body> </html> ------=_Part_8237039_1290629613.1520539290590--