Return-Path: Delivered-To: ajw@transocean.com Received: from vps.transocean.com by vps.transocean.com with LMTP id 4AQvI6UQhlr8UgAAInt2oQ for ; Thu, 15 Feb 2018 14:58:45 -0800 Return-path: Envelope-to: ajw@transocean.com Delivery-date: Thu, 15 Feb 2018 14:58:45 -0800 Received: from mail4.email.thegolfchannel.com ([96.46.140.228]:59823) by vps.transocean.com with esmtps (TLSv1.2:ECDHE-RSA-AES256-GCM-SHA384:256) (Exim 4.89_1) (envelope-from ) id 1emSU0-0005Va-4s for ajw@transocean.com; Thu, 15 Feb 2018 14:58:45 -0800 DKIM-Signature: v=1; a=rsa-sha1; c=relaxed/relaxed; s=default; d=email.thegolfchannel.com; h=Date:From:Reply-To:To:Message-ID:Subject:MIME-Version:Content-Type:list-unsubscribe; i=members@email.thegolfchannel.com; bh=ImD+GwcjKJ+n586VVqGVl5lAk7w=; b=f1z+K2AT8iFO5bQSBI/p6EtZ6ktkL2tdZgTuc24uV6r1FpbGh1zL9kBtVV4eeiZ+aQ8lie4r3i+h fRdOqjH1SA== DomainKey-Signature: a=rsa-sha1; c=nofws; q=dns; s=default; d=email.thegolfchannel.com; b=AIYiHDsDSMcYWi52rKbwJNE8Bs6NJjJbCdSyMdx+Jd/Sqlq9KjqMCEZRNso5fikYrpIA3QlniJ5g jaLiqjWwrw==; Received: by mail4.email.thegolfchannel.com id hgo8a2282akf for ; Thu, 15 Feb 2018 16:57:55 -0600 (envelope-from ) Date: Thu, 15 Feb 2018 16:59:03 -0600 (CST) From: Golf Channel Reply-To: Golf Channel To: "ajw@transocean.com" Message-ID: <1444357084.9056042.1518735543247@email.thegolfchannel.com> Subject: This will help you save 4-8 shots on your next round MIME-Version: 1.0 Content-Type: multipart/alternative; boundary="----=_Part_9056040_2038515645.1518735543247" X-GLFC: pmhlvcqqqjvqbhqhbhffcfclvjf whktqvqhmyvryyqhvgtvdhrgtrqgflysbchdhbhdhcybhmhdcjmjmd hcfyqvvjqq list-unsubscribe: Precedence: Bulk X-Spam-Status: No, score=2.4 X-Spam-Score: 24 X-Spam-Bar: ++ X-Ham-Report: Spam detection software, running on the system "vps.transocean.com", has NOT identified this incoming email as spam. The original message has been attached to this so you can view it or label similar future email. If you have any questions, see root\@localhost for details. Content preview: Click to View Online: http://click1.email.thegolfchannel.com/ViewMessage.do?m=xjddsdjp&r=atltmsm&s=ivbpyqkhchymbctbbhycrkczytrkthrgdbf&q=1518735358&a=view ======================================================== [...] Content analysis details: (2.4 points, 3.0 required) pts rule name description ---- ---------------------- -------------------------------------------------- 0.0 URIBL_BLOCKED ADMINISTRATOR NOTICE: The query to URIBL was blocked. See http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block for more information. [URIs: staticflickr.com] -0.0 T_RP_MATCHES_RCVD Envelope sender domain matches handover relay domain 0.0 T_SPF_TEMPERROR SPF: test of record failed (temperror) 1.1 URI_HEX URI: URI hostname has long hexadecimal sequence 0.0 HTML_MESSAGE BODY: HTML included in message 0.4 HTML_IMAGE_RATIO_02 BODY: HTML has a low ratio of text to image area 0.0 HTML_FONT_LOW_CONTRAST BODY: HTML font color similar or identical to background -0.0 BAYES_40 BODY: Bayes spam probability is 20 to 40% [score: 0.2727] 0.1 DKIM_SIGNED Message has a DKIM or DK signature, not necessarily valid -0.1 DKIM_VALID Message has at least one valid DKIM or DK signature 0.8 CPANEL_LOTS_OF_EMPTY_LINE RAW: Spam that has large block of empty lines X-Spam-Flag: NO ------=_Part_9056040_2038515645.1518735543247 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable Click to View Online:=20= http://click1.email.thegolfchannel.com= /ViewMessage.do?m=3Dxjddsdjp&r=3D= atltmsm= &s=3Divbpyqkhchymbctbbhycrkczytrkthrgdbf&q=3D= 1518735358= &a=3Dview =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D Martin Hall has been teaching golf for nearly 40 years. And he knows the=20= best way to dramatically lower your scores. Martin has teamed up with Revol= ution Golf to bring you a brand new video series called Build a Better Shor= t Game =E2=80=A6 perfect for those who want to: =E2=80=A2 Save 4-8 shots a round =E2=80=A2 Escape any lie from any bunker =E2=80=A2 Hit super-solid chips and pitches =E2=80=A2 Gain superior short game control =E2=80=A2 Finally have a clear plan for short game success=20 =20 http://click1.email.thegolfchannel.com/yfsystrlvlsnkfvpnfflsnvwrvncspwrplwm= gfzbskggm_= tmwmljlklvljmhvhvj= =2Ehtml =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D= =3D=3D=3D=3D=3D=3D To unsubscribe from GolfChannel.com emails, click here www.golfchannel.com/= user/unsubscribe/?email=3D= ajw@transocean.com= &newsletter=3D= 5 =20 7580 Golf Channel Drive, Orlando, FL 32819. ------=_Part_9056040_2038515645.1518735543247 Content-Type: text/html; charset=UTF-8 Content-Transfer-Encoding: quoted-printable =09=20 =09=20 =09=20 =20 =09Golf Channel =20
=20
Martin Hall wants to fix your short game =20
=20 =20 =09=09=09=09 =20 =20 =20
3D"Revolution =09=09=09=09
=20 =20 =20 =20 =20 =20 =20 =09=09=09=09 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20 =20
3D"Improv= =09=09=09=09
=20 =20 BUILD A BULLETPROOF SHORT GAME
=20 =20 Martin Hall has been teaching golf for nearly 40 years. And= he knows the best way to dramatically lower your scores. Martin has teamed= up with Revolution Golf to bring you a brand new video series called Build= a Better Short Game =E2=80=A6 perfect for those who want to: =20 =20 =20
=20 =20 • Save 4-8 shots a round
• Escape any lie from any bunker • Hit super-solid chips and pitches
• Gain superior short game control
• Finally have a clear plan for short game success =20 =20 =20
=20 =20 =20 =20
    Improve Your Short Game     
=20
=20
View as a Web Page

7580 Golf Channel Dr, Orlando, FL 32819

unsubscribe
3D""
=20
=20
------=_Part_9056040_2038515645.1518735543247--