Envelope-to: ajw@transocean.com
Delivery-date: Wed, 03 Jan 2018 13:26:23 -0800
DomainKey-Signature: a=rsa-sha1; c=nofws; q=dns; s=default; d=email.thegolfchannel.com;
 b=cqc+deVkqS7GTJ6A/bwbdu7DRCVqkP14xd8T/7f5hjzzSMf/ZbqO+1iIH1HIxaDFdFZThFU3smfY
   Cvs3baXkgw==;
Date: Wed, 3 Jan 2018 15:25:01 -0600 (CST)
From: Golf Channel <members@email.thegolfchannel.com>
Reply-To: Golf Channel <r-fqggdrdwdgjdbwtdlzsysdjbycbbsdypzyrdcpzcspqnbf@email.thegolfchannel.com>
To: "ajw@transocean.com" <ajw@transocean.com>
Message-ID: <1123052376.20568024.1515014701014@email.thegolfchannel.com>
Subject: =?UTF-8?B?SXTigJlzIFRpbWUgZm9yIGFuIEFsbC1O?=
 =?UTF-8?B?ZXcgRmFudGFzeSBHb2xmIFNlYXNvbiE=?=
MIME-Version: 1.0
Content-Type: multipart/alternative; 
	boundary="----=_Part_20568023_1048621157.1515014701014"
 
 Content preview:  Fantasy Central ==================================================================
    The 2018 Fantasy Golf season tee’s off this week from Hawaii at the Sentry
    Tournament of Champions. With two contests now available, you can play our
    Golf Channel Weekly Contest or our all-new One & Done Season Long Contest
    where you pick one player each week but once you pick a player, they’re
    done for the season. Have some skin in the game and watch along with real-time
    scoring updates. Don’t let your friends miss out on the action; create
   a league for fun all season long. [...] 
 
 Content analysis details:   (-1.9 points, 3.0 required)
 
  pts rule name              description
 ---- ---------------------- --------------------------------------------------
 -0.0 T_RP_MATCHES_RCVD      Envelope sender domain matches handover relay
                             domain
  0.0 URIBL_BLOCKED          ADMINISTRATOR NOTICE: The query to URIBL was blocked.
                             See
                             http://wiki.apache.org/spamassassin/DnsBlocklists#dnsbl-block
                              for more information.
                             [URIs: efeedbacktrk.com]
  0.0 T_SPF_TEMPERROR        SPF: test of record failed (temperror)
 -1.9 BAYES_00               BODY: Bayes spam probability is 0 to 1%
                             [score: 0.0000]
  0.0 HTML_FONT_LOW_CONTRAST BODY: HTML font color similar or identical to
                             background
  0.0 HTML_MESSAGE           BODY: HTML included in message
  0.0 HTML_IMAGE_RATIO_06    BODY: HTML has a low ratio of text to image area
  0.1 DKIM_SIGNED            Message has a DKIM or DK signature, not necessarily valid
 -0.1 DKIM_VALID             Message has at least one valid DKIM or DK signature
X-Spam-Flag: NO

------=_Part_20568023_1048621157.1515014701014
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: quoted-printable

Fantasy Central
=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=
=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=
=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D
The 2018 Fantasy Golf season tee=E2=80=99s off this week from Hawaii at the=
 Sentry Tournament of Champions.=20

With two contests now available, you can play our Golf Channel Weekly Conte=
st or our all-new One & Done Season Long Contest where you pick one player=
 each week but once you pick a player, they=E2=80=99re done for the season.=
  Have some skin in the game and watch along with real-time scoring updates=
.=20
Don=E2=80=99t let your friends miss out on the action; create a league for=
 fun all season long.=20

Make Picks http://click1.email.thegolfchannel.com/esyjrwlsqsrfbtqvfttsrfqcl=
qfprvclvscdhtkzddtyq_=
kdpdlfl=
=2Ehtml=20


=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=
=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=
=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D=3D
This newsletter was sent to you because you are a registered user and subsc=
riber of GolfChannel.com and/or GolfNow.com.=20

To unsubscribe from this GolfChannel.com newsletter, please click to be rem=
oved.
http://www.email.thegolfchannel.com/Unsub.do?=
a=3Du&e=3D=
ajw%40transocean.com=
&mid=3D17514&sid=3DB1CD2921-549A-4421-9ED9-81AEDA2E064F&rid=3D=
7181=
&lid=3D6

Please DO NOT REPLY TO THIS MESSAGE. For all inquiries, please click here.
If you are having problems contacting us, send a letter c/o Webmaster to=20=
7580 Golf Channel Drive, Orlando, FL 32819.
------=_Part_20568023_1048621157.1515014701014
Content-Type: text/html; charset=UTF-8
Content-Transfer-Encoding: quoted-printable

<!DOCTYPE html>
<html xmlns=3D"http://www.w3.org/1999/xhtml">
<head>
=09<meta charset=3D"utf-8"> <!-- utf-8 works for most cases -->
=09<meta name=3D"viewport" content=3D"width=3Ddevice-width"> <!-- Forcing=
 initial-scale shouldn't be necessary -->
=09<meta http-equiv=3D"X-UA-Compatible" content=3D"IE=3Dedge"> <!-- Use the=
 latest (edge) version of IE rendering engine -->
    <meta name=3D"x-apple-disable-message-reformatting">  <!-- Disable auto=
-scale in iOS 10 Mail entirely -->
=09<title></title> <!-- The title tag shows in email notifications, like=20=
Android 4.4. -->

=09<!-- Web Font / @font-face : BEGIN -->
=09<!-- NOTE: If web fonts are not required, lines 10 - 27 can be safely=20=
removed. -->

=09<!-- Desktop Outlook chokes on web font references and defaults to Times=
 New Roman, so we force a safe fallback font. -->
=09<!--=
[if mso]=
>
=09=09<style>
=09=09=09* {
=09=09=09=09font-family: sans-serif !important;
=09=09=09}
=09=09</style>
=09<!=
[=
endif]=
-->

=09<!-- All other clients get the webfont reference; some will render the=
 font and others will silently fail to the fallbacks. More on that here:=20=
http://stylecampaign.com/blog/2015/02/webfont-support-in-email/ -->
=09<!--=
[if !mso]=
><!-->
=09=09<!-- insert web font reference, eg: <link href=3D'https://fonts.googl=
eapis.com/css?family=3DRoboto:400,700' rel=3D'stylesheet' type=3D'text/css'=
> -->
=09<!--<!=
[=
endif]=
-->

=09<!-- Web Font / @font-face : END -->

=09<!-- CSS Reset -->
    <style>

=09=09/* What it does: Remove spaces around the email design added by some=
 email clients. */
=09=09/* Beware: It can remove the padding / margin and add a background=20=
color to the compose a reply window. */
        html,
        body {
=09        margin: 0 auto !important;
            padding: 0 !important;
            height: 100% !important;
            width: 100% !important;
        }

        /* What it does: Stops email clients resizing small text. */
        * {
            -ms-text-size-adjust: 100%;
            -webkit-text-size-adjust: 100%;
        }

        /* What is does: Centers email on Android 4.4 */
        div=
[style*=3D"margin: 16px 0"]=
 {
            margin:0 !important;
        }

        /* What it does: Stops Outlook from adding extra spacing to tables.=
 */
        table,
        td {
            mso-table-lspace: 0pt !important;
            mso-table-rspace: 0pt !important;
        }

        /* What it does: Fixes webkit padding issue. Fix for Yahoo mail tab=
le alignment bug. Applies table-layout to the first 2 tables then removes=
 for anything nested deeper. */
        table {
            border-spacing: 0 !important;
            border-collapse: collapse !important;
            table-layout: fixed !important;
            margin: 0 auto !important;
        }
        table table table {
            table-layout: auto;
        }

        /* What it does: Uses a better rendering method when resizing image=
s in IE. */
        img {
            -ms-interpolation-mode:bicubic;
        }

        /* What it does: A work-around for iOS meddling in triggered links.=
 */
        *=
[=
x-apple-data-detectors]=
 {
            color: inherit !important;
            text-decoration: none !important;
        }

        /* What it does: A work-around for Gmail meddling in triggered link=
s. */
        .x-gmail-data-detectors,
        .x-gmail-data-detectors *,
        .aBn {
            border-bottom: 0 !important;
            cursor: default !important;
        }

        /* What it does: Prevents Gmail from displaying an download button=
 on large, non-linked images. */
        .a6S {
=09        display: none !important;
=09        opacity: 0.01 !important;
        }
        /* If the above doesn't work, add a .g-img class to any image in=20=
question. */
        img.g-img + div {
=09        display:none !important;
=09   =09}

        /* What it does: Prevents underlining the button text in Windows=20=
10 */
        .button-link {
            text-decoration: none !important;
        }

        /* What it does: Removes right gutter in Gmail iOS app: https://git=
hub.com/TedGoas/Cerberus/issues/89  */
        /* Create one of these media queries for each additional viewport=
 size you'd like to fix */
        /* Thanks to Eric Lepetit @ericlepetitsf) for help troubleshooting=
 */
        @media only screen and (min-device-width: 375px) and (max-device-wi=
dth: 413px) { /* iPhone 6 and 6+ */
            .email-container {
                min-width: 375px !important;
            }
        }

    </style>

    <!-- Progressive Enhancements -->
    <style>

        /* What it does: Hover styles for buttons */
        .button-td,
        .button-a {
            transition: all 100ms ease-in;
        }
        .button-td:hover,
        .button-a:hover {
            background: #555555 !important;
            border-color: #555555 !important;
        }

        /* Media Queries */
        @media screen and (max-width: 600px) {

            .email-container {
                width: 100% !important;
                margin: auto !important;
            }

            /* What it does: Forces elements to resize to the full width=20=
of their container. Useful for resizing images beyond their max-width. */
            .fluid {
                max-width: 100% !important;
                height: auto !important;
                margin-left: auto !important;
                margin-right: auto !important;
            }

            /* What it does: Forces table cells into full-width rows. */
            .stack-column,
            .stack-column-center {
                display: block !important;
                width: 100% !important;
                max-width: 100% !important;
                direction: ltr !important;
            }
            /* And center justify these ones. */
            .stack-column-center {
                text-align: center !important;
            }

            /* What it does: Generic utility class for centering. Useful=20=
for images, buttons, and nested tables. */
            .center-on-narrow {
                text-align: center !important;
                display: block !important;
                margin-left: auto !important;
                margin-right: auto !important;
                float: none !important;
            }
            table.center-on-narrow {
                display: inline-block !important;
            }

        }

    </style>

</head>
<body width=3D"100%" bgcolor=3D"#f4f4f4" style=3D"margin: 0; mso-line-heigh=
t-rule: exactly;">
    <center style=3D"width: 100%; background: #f4f4f4; text-align: left;">

        <!-- Visually Hidden Preheader Text : BEGIN -->
        <div style=3D"display:none;font-size:1px;line-height:1px;max-height=
:0px;max-width:0px;opacity:0;overflow:hidden;mso-hide:all;font-family: sans=
-serif;">
            The 2018 Fantasy Golf season tees off this week from Hawaii at=
 the Sentry Tournament of Champions.  =20
        </div>
        <!-- Visually Hidden Preheader Text : END -->

        <!-- Email Header : BEGIN -->
        <table role=3D"presentation" cellspacing=3D"0" cellpadding=3D"0"=20=
border=3D"0" align=3D"center" width=3D"600" style=3D"margin: auto;" class=
=3D"email-container">
=09=09=09
           =20
           =20
             <tr>
=09=09=09=09<td bgcolor=3D"#ffffff"><a href=3D"http://click1.email.thegolfc=
hannel.com/xvbkdqlvcvdtrpcntppvdtcylctsdnylnvygbpmjggphb_=
kdpdlfl=
=2Ehtml"><img src=3D"https://c1.staticflickr.com/1/593/31440075893_149e77f8=
18_o.jpg" width=3D"600" height=3D"100" alt=3D"Fantasy" border=3D"0" align=
=3D"center" style=3D"width: 100%; max-width: 600px; height: auto; backgroun=
d: #dddddd; font-family: sans-serif; font-size: 15px; line-height: 20px;=20=
color: #555555;" class=3D"g-img"></a>
=09=09=09=09</td>
            </tr>
       =20
        <!-- Email Header : END -->

        <!-- Email Body : BEGIN -->
       =20

           =20
            <tr>
                <td bgcolor=3D"#e2e2e2">
                    <table role=3D"presentation" cellspacing=3D"0" cellpadd=
ing=3D"0" border=3D"0" width=3D"100%">
                    =09<tr>
                            <td style=3D"padding: 10px 10px 10px 10px; font=
-family: sans-serif; font-size: 20px; line-height: 28px;  color: #333; text=
-align:center;""><strong>It=E2=80=99s Time for an All-New Fantasy Golf Seas=
on!</strong></td>
=09=09=09=09=09  </tr>
                    </table>
                </td>
            </tr>
           =20
            <!-- Hero Image, Flush : BEGIN -->
            <tr>
=09=09=09=09<td bgcolor=3D"#ffffff"><a href=3D"http://click1.email.thegolfc=
hannel.com/pqmwhktqvqhbmyvrbyyqhbvgtvbdhrgtrqgflyscffyjc_=
kdpdlfl=
=2Ehtml"><img src=3D"https://c1.staticflickr.com/5/4634/24612764857_b8b0517=
21e_o.jpg" width=3D"600" alt=3D"Fantasy" border=3D"0" align=3D"center" styl=
e=3D"width: 100%; max-width: 600px; height: auto; background: #dddddd; font=
-family: sans-serif; font-size: 15px; line-height: 20px; color: #555555;"=
 class=3D"g-img"></a>
=09=09=09=09</td>
            </tr>
            <!-- Hero Image, Flush : END -->

            <!-- 1 Column Text : BEGIN -->
            <tr>
                <td bgcolor=3D"#ffffff" style=3D"padding: 40px; text-align:=
 left; font-family: sans-serif; font-size: 16px; line-height: 20px; color:=
 #555555;">
                   The 2018 Fantasy Golf season tees off this week from Haw=
aii at the Sentry Tournament of Champions. <br>
                   <br>
With two contests now available, you can play our <strong><em>Golf Channel=
 Weekly Contest</em></strong> or our all-new <strong><em>One & Done Season=
 Long Contest</em> </strong>where you pick one player each week but once=20=
you pick a player, they=E2=80=99re done for the season. Have some skin in=
 the game and watch along with real-time scoring updates.  <br><br>
Don=E2=80=99t let your friends miss out on the action; create a league for=
 fun all season long.=20

                    <br><br><br>
                    <!-- Button : Begin -->
                    <table role=3D"presentation" cellspacing=3D"0" cellpadd=
ing=3D"0" border=3D"0" align=3D"center" style=3D"margin: auto">
                        <tr>
                            <td style=3D"border-radius: 3px; background:=20=
#009ddc; text-align: center;" class=3D"button-td">
                                <a href=3D"http://click1.email.thegolfchann=
el.com/bljvpmklzlpygjzsyjjlpyznkzybpsnkslndqjtcddjfb_=
kdpdlfl=
=2Ehtml" style=3D"background: #009ddc; border: 15px solid #009ddc; font-fam=
ily: sans-serif; font-size: 18px; line-height: 1.1; text-align: center; tex=
t-decoration: none; display: block; border-radius: 3px; font-weight: bold;"=
 class=3D"button-a">
                                    &nbsp;&nbsp;&nbsp;&nbsp;<span style=3D"=
color:#ffffff;">Make Picks</span>&nbsp;&nbsp;&nbsp;&nbsp;
                                </a>
                            </td>
                        </tr>
                    </table>
                    <!-- Button : END -->
                </td>
            </tr>
          =20
            <!-- 1 Column Text + Button : BEGIN -->

        </table>
        <!-- Email Body : END -->

        <!-- Email Footer : BEGIN -->
        <table role=3D"presentation" cellspacing=3D"0" cellpadding=3D"0"=20=
border=3D"0" align=3D"center" width=3D"600" style=3D"margin: auto;" class=
=3D"email-container">
            <tr>
                <td style=3D"padding: 40px 10px;width: 100%;font-size: 12px=
; font-family: sans-serif; line-height:18px; text-align: center; color: #88=
8888;" class=3D"x-gmail-data-detectors">
                    <webversion style=3D"color:#cccccc; text-decoration:und=
erline; font-weight: bold;"><a style=3D"text-decoration:none; color: #999;"=
 href=3D"=
http://click1.email.thegolfchannel.com=
/ViewMessage.do?m=3Dfhrdgjdb&r=3D=
kdpdlfl=
&s=3Dbfjvpmklzlpgjzsjjlpznkzbpsnkslndqjt&q=3D=
1515014648=
&a=3Dview">View as a Web Page</a></webversion>
                    <br><br>
                    Golf Channel<br>
7580 Golf Channel Drive <br>
Orlando, FL 32819 <br><br><img src=3D"https://dafe90.efeedbacktrk.com/xvjkd=
qlvcvdtrpcntppvdtcylctsdnylnvygbpmjggphr_=
kdpdlfl=
=2Egif" width=3D"0" height=3D"0" alt=3D"">
                    <unsubscribe style=3D"color:#888888; text-decoration:un=
derline;"><a style=3D"text-decoration:none; color: #999;" href=3D"=
http://www.email.thegolfchannel.com/Unsub.do?=
a=3Du&e=3D=
ajw%40transocean.com=
&mid=3D17514&sid=3DB1CD2921-549A-4421-9ED9-81AEDA2E064F&rid=3D=
7181=
&lid=3D6">unsubscribe</a></unsubscribe>
                </td>
            </tr>
        </table>
        <!-- Email Footer : END -->

    </center>
</body>
</html>
------=_Part_20568023_1048621157.1515014701014--